06-reference/transcripts

Satya Nadella on Dwarkesh Patel — How Microsoft thinks about AGI

2026-04-19·transcript·source: Dwarkesh Patel YouTube·by Dwarkesh Patel, Dylan Patel, Satya Nadella
transcriptdwarkeshsatya-nadellamicrosoftazurefairwateropenaiagiscalingsovereign-aifungibility

Satya Nadella on Dwarkesh Patel — Transcript

Source: https://www.youtube.com/watch?v=8-boBsWcr5A Captured: 2026-04-19 via yt-dlp (English auto-captions, en track). Auto-captions: punctuation approximate, speaker turns inferred.


Maybe after the industrial revolution, this is the biggest thing. But at the same time, I'm a little grounded in the fact that this is still early innings. If you're a model company, you may have a winner's curse. You may have done all the hard work, done unbelievable innovation, except it's kind of like one copy away from that being commoditized. We didn't want to just be a host for one company and have just a massive book of business with one customer. That that's not a business. You can't build an infrastructure that's optimized for one model. If you did that, you're one tweak away. Some like breakthrough that happens and your entire network topology goes out of the window. Then that's a scary thing. Our business, which today is an enduser tools business, will become essentially an infrastructure business in support of agents doing work. The thing

that you have to think through is not what you do in the next 5 years, but what do you do for the next 50. >> Today we are interviewing Satya Nadella. We being me and Dylan Patel who is founder of semi analysis. Satya, welcome. >> Thank you. It's great. Thanks for coming over at Atlanta. >> Yeah, thank you for giving us a tour of uh the new facility. It's been really cool to see. >> Absolutely. >> Satya and Scott Guthrie, Microsoft's EVP of cloud and AI, give us a tour of their brand new Fairwater 2 data center, the current most powerful in the world. >> We try to 10x the training capacity every 18 to 24 months. And so this would be effectively a 10x increase 10x from what GPD5 was trained with. And so to put in perspective, the number of optics, the network

optics in this building is almost as much as all of Azure across all our data centers 2 and a half years ago. >> It's kind of what 5 million network connections. >> You've got all this bandwidth between different sites in a region and between the two regions. So is this like a big bet on scaling in the future that you anticipate in the future there's going to be some huge model that needs to require two whole different regions to train >> the goal is to be able to kind of aggregate these flops for a large training job and then put these things together across size >> right >> and the reality is you'll use it for uh training and then you'll use it for data gen you'll use it for inference in all sort of ways it's not like it's going to be used only

for one workload forever >> water four which you're going to see under construction nearby. >> Yeah. We'll also be on that one pedits network. >> Yep. >> So that we can actually link the two at a very high rate. And then basically we do the IWAN connecting to Milwaukee where we have multiple other fair waters being built. >> Literally you can see the the model parallelism and the data parallelism. It's kind of built for um essentially the training jobs, the pods, the super pods across this campus. And then with the van, you can go to the Wisconsin data center and literally run a training job with all of them getting aggregated. >> And what we're seeing right here is this is a cell with no servers in it yet. No racks. >> How many uh racks are in a cell? >> Let me think about

it. We don't necessarily share that per se, but but we let me >> The reason I asked you'll see upstairs you can start counting. We'll let you start counting. How many cells are there in this building? >> That part also I can't tell you. Well, division is easy, right? >> My god, it's kind of loud. >> Are you looking at this like now I see where my money is going? >> It's kind of like I run a software company. Welcome to the software company. >> How big is the design space once you've decided to use GB200's and NVIL? How many other decisions are there to be made? There is coupling from the model architecture to what is the physical plan that's optimized >> and it's also scary in that sense which is hey there's going to be a new chip that will come out which

obviously I mean you take Vera Rubin ultra I mean that's going to have power density that's going to be so different with cooling requirements that are going to be so different right so you kind of don't want to just build all to one spec so that goes back a little to I think the dialogue we'll have which is >> you want to be scaling in time >> as opposed to scale once and then be stuck with it. >> When you look at all the past technological transitions whether it be you know railroads or the internet or you know replaceable parts and translization uh the cloud all of these things each revolution has gotten much faster in the time it goes from technology discover to ramp and pervasiveness through the economy. Many folks who have been on Darkesh's podcast believe this is sort of the final

uh technological revolution or transition and this time is very very different. Um and at least so far in the markets it's sort of you know in three years we've already skyrocketed to you know hyperscalers are doing $500 billion of capex next year which is a scale that's un unmatched to prior revolutions in terms of speed and the end state seems to be quite different. How how do you your your framing of this seems quite different than sort of the I would say the AI bro who is who is quite um you know AGI is coming and you know I'd like to understand that more. >> Yeah. I mean look I I I start with the excitement that I also feel for maybe after the industrial revolution this is the biggest thing. Um and so therefore I I I I I start with that premise. uh

but at the same time I'm a little grounded in the fact that uh this is still early innings. Uh we've built some very useful things. We're seeing some great properties. These scaling laws seem to be working. Um and I'm optimistic that they'll continue to work right. Some of it is um you know it does require real science breakthroughs but it's also a lot of engineering and what have you. But that said, I also sort of take the view that you know even what has been happening in the last 70 years of computing uh has also been a march uh that has helped us move um you know with as I said you know I like one of the things that Raj ready has as a metaphor for what AI is right he's a he's a turing award winner out of CMU um and he's always

I think he had this even pre- AGI but he had this metaphor of AI should either be a guardian angel or a cognitive amplifier. I love that uh it's a simple way to think about what this is ultimately what is its human utility? It is going to be a cognitive amplifier uh and a guardian angel. And so if I sort of view it that way, I view it as a tool. But then you can also go very mystical about it and say, "Wow, this is you know more than a tool. It does all these things which only humans did so far." But that has been the case with many technologies in the past. only humans did a lot of things and then we add tools that did them. >> I guess we don't have to get wrapped up in their definition here, but maybe one

way to think about it is like maybe it takes 5 years, 10 years, 20 years. At some point eventually a machine is producing Satya tokens, right? And the Microsoft board thinks that Satia tokens are worth a lot. >> How much how much are you wasting of his of like economic value by interviewing Satya? >> You cannot afford the API cost of Satia tokens. Um but so you know whatever you want to call it is that are the SATA tokens a tool or an agent whatever. Um right now if you have models that cost on the order of dollars or cents per million tokens there's just an enormous room for expansion uh a margin expansion there where sad a million tokens of SA are like worth a lot um and where does that margin go and what level of that margin is Microsoft involved in is

a question I have. So I think um in in some sense this goes back a band to essentially what's the economic growth picture going to really look like? Um what's the firm going to look like? What's productivity going to look like? And that to me is where again if the industrial revolution created after whatever 70 years of diffusion is when you started seeing the economic growth, right? it took that's the other thing to remember is um even if the tech is diffusing fast uh this time around for true economic growth to appear it has to sort of diffuse to a point where the work the work artifact and the workflow has to change and so that's kind of one place where I think uh the change management required for a corporation to truly change I think is something we shouldn't discount so I think going

forward do humans and the tokens they produce get higher leverage, right? Uh whether it's the Dark Cesh or the Dylan tokens of the future. I mean, think about the amount of techn would you be able to run semi analysis or this podcast without technology? No chance, right? I mean, the scale that you have been able to achieve, no chance. So, the question is what's that scale? Is it going to be 10xed with something that comes through? Uh absolutely. uh and therefore within your ramp to some revenue number or your ramp to some audience number or what have you and so that I think is what's going to happen right I mean the the point is uh that's whatever what took 70 years maybe 150 years for the industrial revolution may happen in 20 years 25 years that's a better way to like I would love

to compress what happened in 200 years of the industrial revolution into 20-year period if you're lucky >> so Microsoft historically has been perhaps you know the greatest software company the largest software as a service company you know you've gone through a transition in the past where you used to sell Windows licenses and discs of Windows or Microsoft and now you sell you know subscriptions to 365 or um as as we go from sort of you know that transition to where your business is today um there's also a transition going after that right uh software as a service incredibly low incremental cost per user uh there's a lot of R&D there's a lot customer acquisition cost. This is why not Microsoft but the SAS companies have underperformed massively in the markets because the cogs of AI is just so high and that just completely breaks how

these business models work. >> How do you as a as as a as perhaps the greatest software company um software as a service company transition Microsoft to this new age where COGS matters a lot um and and the incremental cost per users is different right because right now you're charging hey it's 20 bucks for a co-pilot. >> Yeah. So I think that this is a it's a great question because in some sense the business models themselves I think the levers are going to remain similar right which is if I look at the the if if you look at the menu of models uh starting from like say consumer all the way right there will be some ad unit uh there will be some transaction there will be some device gross margin for somebody who builds an AI device um uh there will be subscriptions consumer

and enterprise uh and then there'll be consumption right so I still think that that's kind of how those are all the meters. To your point, what is a subscription? Up to now, people like subscriptions because they can budget for them, right? They are essentially entitlements to some consumption rights that come encapsulated in a subscription. So that I think is what in some sense it becomes a pricing decision. Uh so how much consumption is in you are entitled to is if you look at all the coding subscriptions that's kind of what they are, right? and they kind of have the pro tier, the standard tier and what have you. And so I think that's how the pricing will uh you know and the margin structures will get tiered. Um the interesting thing is having at Microsoft the good news for us is we kind of are

in that business uh all in across all those meters. in fact that at a as a portfolio level uh we pretty much have consumption subscriptions uh to all of the other consumer levers as well. Um and then I think time will tell which of these models make sense in what categories. Um, one thing on the SAS side since you brought up which I think a lot about is uh take uh Office 365 or Microsoft 365. I mean man having a low RPO is great because here here's an interesting thing right during the transition from server to cloud one of the questions we used to ask ourselves is oh my god if all we did was just basically move the same users who were using let's call it our office licenses and our servers at that time office servers right to the cloud and we had

cogs this is going to basically not only shrink our margins uh but we'll be fundamentally a nonprofitable I mean less profitable company except What happened was the move to the cloud expanded the market like crazy. Uh right I mean we sold a few servers in India didn't sell much whereas in the cloud suddenly everybody in India also could afford fractionally buying uh servers. The IT costs I in fact the biggest thing I had not realized for example was the amount of money people were spending buying storage underneath SharePoint. In fact, EMC's biggest segment may have been storage servers for SharePoint. All that sort of dropped in the cloud because nobody had to go buy in fact it was working capital. I mean basically it is cash flow out right and so it expanded the market massively. So this AI thing will be that right. So

if you take coding um what we built with GitHub and VS code in over whatever decades uh suddenly the coding assistant is that big in one year and so that I think is what's going to happen as well which is the market expands massively. M I I guess there's a question of the market will expand. Will the parts of the revenue that touch Microsoft expand? So copilot is an example where if you look uh early this year I think uh I guess according to Dylan's numbers um the co-pilot revenue github co-pilot revenue was like 500 million or something like that and then u there were like no close competitors whereas now you have claude code cursor and copilot with around similar revenue around a billion and then codeex is catching up around 700 800 million and so the question is across all the services that

Microsoft has access to what is the advantage that mic Microsoft's equivalents of Copilot have. >> Yeah, by the way, I love this chart. You know, I love this chart for so many reasons. One is we're still on the top. >> Um, second is all these companies that are listed here are all companies that have been born in the last four or five years. >> Yeah, >> that to me is the best sign, right? Which is if you have new competitors, new existential problems, when you say, man, who's it now? Claude's going to kill you. Cursor is going to kill you. It's not Borland, right? So, thank God. like that means we are in the right direction but this is it right the fact that we went from nothing to this scale is the market expansion so this is like the cloud-like stuff this fundamentally this

category of coding and AI is probably going to be one of the biggest categories right it is a software factory category in fact it may be bigger than knowledge work >> so I kind of want to keep myself open-minded about I mean we're going to have tough competition I think that's your point which I think is a great on uh but man like I'm glad we have we parlayed uh what we had into this and now we have to compete and so in the compete side uh even in the last quarter we just we did our quarterly uh announcement I think we grew from 20 to 26 million subs right so I feel good about our sub growth uh and where the direction of travel on that is but the more interesting thing that has happened is guess where all the repos of all these

other guys uh who are generating lots and lots of code go to they go to GitHub so it GitHub is at an all-time high in terms of repo creation PRs everything so that in some sense we want to keep that open by the way that means we want to have that right because we don't want to conflate that with our own growth right the interestingly enough we're getting one developer joining GitHub a second or something that is the stat I think and then 80% of them just fall into some GitHub copilot uh workflow just because there are and by the way many of these things will even use some of our coding code review agents which are by default on just because you can use it. So we'll have many many structural shots at this. The thing that we're also going to do is what

we did with git g get the primitives of github whether starting with git to issues to actions these are powerful lovely things because they kind of are all built around your repo. So we want to extend that last week at GitHub Universe. That's kind of what we did, right? So we said agent HQ was the conceptual thing that we said we're going to build out. This is where for example you have a thing called mission control and you go to mission control and now I can fire off sometimes I describe it as the cable TV of all these AI agents because I'll have essentially packaged into one subscription codeex claude um you know cognition staff anyone's agents gro all of them will be there so I get one package and then I can literally go issue a task steer them so they'll all be working

in their independent branches. Uh I can monitor them. Uh so I literally have because I think that's going to be one of the biggest places of innovation, right? Because right now I want to be able to use multiple agents. I want to be able to then digest the output of the multiple agents. I want to be able to then keep a h a handle on my repo. So if there's some some kind of a heads up display that needs to be built and then for me to quickly steer and triage what the coding agents have generated that to me between VS code GitHub and all of these new primitives we'll build uh as mission control I think uh with a control plane observability I mean think about every uh one who is going to deploy all this will require a whole host of observability of

what agent did what at what time to what code base so I feel that's the opport opportunity uh and at the end of the day your point is well taken which is we better be competitive and innovate and if we don't yes we will get toppled but I like the chart at least as long as we're on the top even with competition >> the key point here is sort of that GitHub will keep growing irregardless of whose coding agent wins but that that market only grows at you know call it 10 15 20% which is way above GDP it's a great compounder but these AI coding agents have grown from you know call it $500 million run rate at the end of last year which was basically ally just GitHub copilot to now the current run rate across you know GitHub copilot cloud code cursor

cognition wind surflet uh codeex open codeex that's that's that's run rating at 56 billion now um for the for the Q4 of of this year that's a 10x right and and when you look at hey what's the TAM of of software agents is it is it the $2 trillion of wages you pay people or is it is it is it something beyond that uh because every company in the will now be able to, you know, develop software more. >> No question Microsoft takes a slice of that, but you've gone from near 100% or certainly way above 50% to, you know, sub 25% market share in just one year. What is the sort of confidence that people can get that Microsoft >> there's no again it goes back a little bit D to sort of there's no birthright here that we should have any confidence other

than to say hey we should go innovate and knowing the the lucky break we have in some sense is that uh this category is going to be a lot bigger than anything we had high share in let's let me say it that way right in some sense you could say man we kind of had high share in VS code we had high share in the repos for with GitHub uh uh and that was a good market but the point is even having a decent share in what is a much more expansive market right I mean you could say we had a high share in client server server computing we have much lower share than that in hypers scale but is it a much bigger business by orders of magnitude so at least there's existence proof that Microsoft's been okay uh even if our share position

has not been as strong as it was uh as long as the markets we're competing in creating more value and there are multiple winners. Uh so I think that's the stuff but I I I take your point that ultimately it all means you have to get competitive. So I watch that every quarter and so that's why I think what I'm very optimistic that uh what we're going to do with GitHub HQ and or agent HQ turning GitHub into a place where all these agents come uh as I said we'll have multiple shots on goal on there right it it need not be that hey some of these guys can succeed along with us uh and so it doesn't need to be just one winner uh and one subscription >> I I guess the reason to focus on this question is that it's not just about

GitHub but fundamentally about office and all the other software that Microsoft offers which is that one vision you could have about how I proceeds is that look the models are going to keep being hobbled then you'll need this direct visible um observability all the time and another vision is over time these models can now they're doing tasks that take two minutes in the future they'll be doing tasks that next be tasks that take 10 30 minutes in the future maybe they're doing days worth of work autonomously and then the model companies are charging thousands of dollars maybe for access to really a co-orker which could use any UI to communicate with their human and so forth and migrate between platforms. So if we're getting closer to that, why aren't the model companies that are just getting more and more profitable, the ones that are taking

all the margin, why is the the place where the scaffolding happens, which becomes less and less relevant as a as become more cap capable going to be that important? And that goes to, you know, office as it exists now versus co-workers that are just doing knowledge work. >> Great point. I mean I think that's a I mean for example I mean this is where you know does all the value migrate just to uh the model um and uh or does the you know the does it get split between the scaffolding um and the model and what have you I think that uh time will tell but my my fundamental point also is the incentive structure gets clear right which is if you take um let's take uh let's take information work or take even coding u already in fact one of favorite settings I have

uh in GitHub copilot is called auto um right which will just optimize in fact I buy a subscription the auto one will start picking and optimizing for what I am asking it to do uh and it could even be fully autonomous and it could sort of arbitrage the tokens available across multiple models to go get a task done so if that is the that means that if you take that argument the commodity there will be models uh and especially with open source models you can pick a checkpoint and you can take a bunch of your data and you're seeing it right I think all of us will start you whether it's from cursor or from Microsoft you'll start seeing some in-house models even uh which will and then you'll offload most of your uh task to it so I think that one argument is if

you win the scaffolding uh which today is dealing with all the hobbling problems or the uh the jaggedness of this intelligence problems which you kind of have to um if you win that then you will vertically integrate yourself into the model just because you will have the liquidity of the data and what have you and there are enough and more checkpoints that are going to be available. uh that's the other thing right so structurally I think there will always be an open- source model uh that will be fairly capable in the world that you could then use as long as you have something that you can use that uh with which is data uh and a scaffolding right so I can make the argument that oh my god uh if you're a model company you may be you may have a winner's curse you may

have done all the hard work done unbelievable innovation except it's kind of like one copy uh away from that being commoditized and then the person who has the data for grounding and context engineering um and the liquidity of data can then go take that checkpoint and train it. So I think the argument can be made both ways. >> Unpacking sort of what you said, there's two views of the world, right? One is that models, there's so many different models out there. Open source exists. There will be differences between the models that will drive some level of, you know, who wins and who doesn't, but the scaffolding is what enables you to win. The other view is that actually models are the key IP and yes, we're in a very everyone's in a tight race and there's some, you know, hey, I can use anthropic or

open AAI and you can see this in the revenue charts, right? like OpenAI's revenue started skyrocketing once they finally had a code model similar capabilities to anthropic although in different ways. Um there's a view that like the model companies are actually the ones that garner all the margin right because you know if you look across this year at least on entropic their gross margins on inference went from you know well below 40% to north of 60 right by the end of the year um the these the margins are expanding [clears throat] there despite hey more Chinese open source models than ever hey open's competitive hey Google's competitive hey x Grock is now competitive right all these all these companies are now competitive and yet despite this the margins have expanded at the model layer significantly. Um h how do you think about the >> it's

a it's a great question. I I think that the one thing is perhaps a few years ago people were saying oh I can just wrap a model and build a successful company. Uh and that I think is probably gotten debunked just because the model capabilities um and with tools use in particular. But the interesting thing is there's no like when I look at Office 365. Let's take even this little thing we built called Excel agent. It's interesting right? Excel agent is not a UI level wrapper. It's actually a model that is in the middle tier. Uh in this case because we have all the IP from the the GPT family. uh we are taking that and putting it into the core middle tier of the office system to both teach it what it means to natively understand Excel everything in it. So it's not just

hey I just have a pixel level understanding I have an full understanding of all the native artifacts of Excel uh both when I see it like because if you think about it if I'm going to give it some reasoning task right I need to even fix the reasoning mistakes I make and so that means I need to both not just see the pixels I need to be able to see oh I got that formula wrong and I need to understand that and then so to some degree that's all being done not at the UI wrapper level with some prompt but it's being done in the middle tier by teaching it all the tools of Excel, right? So, I'm giving it even essentially a markdown to teach it the skills of what it means to be a sophisticated Excel user. So, it's a weird thing that

it it goes back a little bit to AI brain, right? Which is you're building not just Excel. You are now business logic in its traditional sense. You're taking the Excel business logic in the traditional sense and wrapping essentially a cognitive layer to it using this model which knows how to use the tool. So in some sense, Excel will come with an analyst bundled in and with all the tools used. >> That's the type of stuff that'll get built by everybody. So even for the model companies, they'll have to compete, right? So if they price stuff high, uh guess what? If I'm a builder of a tool like this, I'll substitute you. I may use you for a while. And so as long as there's competition, there's always a winner take all thing, right? If there's going to be one model that is better than everybody

else with massive distance, yes, that's a winner take all. As long as there's going to be competition where there's multiple models just like hypers scale competition and there's an open- source check, uh there is enough room here uh to go build value on top of models. >> Uh but at Microsoft, the way I look at it and say is uh we are going to be in the hypers scale business which will support multiple models. we will have access to open AI models for uh you know seven more years which we will innovate on top of so royalty I mean essentially I think of ourselves as having a frontier class model uh that we can use and innovate on with full uh flexibility and we'll build our own models uh with Mai um and and so we will always have a model level and then we'll

build these whether it's in security whether it's in knowledge work whether it's in coding or in science we will build our own applications scaffolding which will be model forward right it won't be a wrapper on a model but the model will be wrapped into uh the application I have so many questions about the other things you mentioned but before we move on to those topics um I still wonder whether this is like not forwardlooking on AI capabilities where you're imagining models like they exist today where yeah I can you have to like it takes a screenshot of your screen but it can't like look inside each cell and what the formula is and I think the better mental audited here is like look a human just imagine that these models actually will be able to actually use a computer as well as a human and

a human knowledge worker who is using Excel can look into the formulas can you know use alternative software can migrate data between office 365 and another piece of software if the migration is necessary etc so that's kind of what I'm saying but if that's the case then the integration with Excel doesn't matter that much don't worry about the Excel integration after all Excel was built as a tool for anal analysts. Great. So, whoever is this AI that is an analyst should have tools that they can >> computer, right? Just the way a human can use a computer, that's their tool. >> The the tool is the computer. Right. >> Right. So, that so all I'm saying is I'm building an analyst as as essentially an AI agent uh which happens to come with an a priority knowledge of how to use all of these analytical

tools. But is it is it something maybe just just to make sure we're talking about the same thing. Um is it a thing that a hum like me using Excel as a podcast completely autonomous? So just imagine I work like so we should now maybe sort of lay out how I think the future of the company is right. uh the future of the company would be the tools business which I have a computer I use Excel and in fact in the future I'll even have a co-pilot and that co-pilot will also have agents right that's still I am I you know it's still me steering everything >> and everything is coming back so that's kind of one world >> then the second world is the company just literally provisions a computing resource for an AI agent >> and that is working fully autonomously >> that

fully autonomous agent will have essentially embodied set of those same tools, >> right? >> Uh that are available to it, right? So this AI tool that comes in also has not just a raw computer uh because it's going to be more token efficient to use tools to get stuff done. In fact, I kind of look at it and say our business which today is an enduser tools business will become essentially an infrastructure business in support of agents doing work. Is there another way to think about it? Right? So if one of the things that you'll see us do in in in fact like all the stuff we built underneath M365 still is going to be very relevant uh you need someplace to store it someplace to do archival someplace to do discovery someplace to manage all of these activities even if you're an AI agent.

So that's so it's kind of a new infrastructure. So ju just to make sure I understand you're saying like look theoretically a future AI that has actual computer use which is all these companies are working on model companies are working right now could use even if it's not partnered with Microsoft or under our umbrella could use Microsoft software but you're saying we're going to give them if if you're working with our infrastructure we're going to give you like lower level access that makes it more efficient for you to do the same things you could have otherwise done anyways. >> 100%. I mean so the entire thing in in fact the way the you know like what happened is we had servers then there was virtualization and they had many more servers. So that's another way to think about this which is hey don't think

of this the tool as the end thing what is the entire substrate underneath that tool that humans use and that entire substrate is the bootstrap for the AI agent as well because the AI agent needs a computer that's kind of one like you know so in fact one of the fascinating things we're seeing a significant amount of growth is all these guys who are doing these office artifacts and and what have you as autonomous agents and so on want to provision Windows 365 right? They really want to be able to provision a computer for these agents. Uh and so absolutely and that's where I think we're going to have essentially an enduser computing infrastructure business which I think is going to just keep growing because guess what it's going to grow faster than the number of users. So in fact that's kind of one of

the other questions people ask me is hey what happens to the per user business at least the early signs may be the way to think about the per user business is not just per user it's per agent and if you sort of say it's per user and per agent the key is what's the stuff to provision for every agent a computer u a set of security things around it an identity around it uh and all those things observability and so on are the management layers and that's I think all going to get baked into that >> the way to frame it at least the way I currently think about it and I'd like to hear your you know your view is that >> uh these model companies are all building environments to train their models to use Excel or Amazon shopping or whatever whatever it

is book flights um but at the same time they're also training these models to do migration from because that that is probably the most immediate uh valuable thing right converting mainframe based systems to standard cloud systems converting um Excel databases into real databases uh with SQL, right? Or or converting um you know what is done in Word and Excel to something that is more programmatic and more efficient in a classical sense that can actually be done by humans as well. It's just not cost-ffective for the software developer to do that. That seems to be what everyone is going to do with AI for the next, you know, few years at least to massively drive value. Um h how does Microsoft fit into that? if the models can utilize the tools themselves to migrate to something and yes Microsoft has you know a leadership position in

databases and in storage and and in all these other categories but the use of say a office ecosystem is going to be significantly less just like potentially the use of a mainframe ecosystem could be potentially less now mainframes have grown for the last two decades actually even though no one talks about them anymore they've still grown 100% I agree with that how does how does that flow forward >> I mean at the end of the day This is not about sort of hey u there is going to be a significant amount of time where there's going to be a hybrid world right because people are going to be using the tools that are going to be working with agents that have to use tools and by the way they have to communicate with each other what's the artifact I generate that then a human needs

to see so like all of these things will be real considerations in any place so the outputs input so I don't think it'll just be about oh I migrate it off right but the bottom line is I have to live in this hybrid world so let's but that doesn't fully answer your question because there can be a real new efficient frontier where I it's just agents working with agents uh and completely optimizing and even when agents are working with agents what are the primitives that are needed uh do you need a storage system >> uh does that storage system need to have eiscocovery does that eiscocovery do you need to have observability do you need to have an identity system that is going to use multiple models with all having one identity system so these are all the core underlying rails we have today for

what are office systems or what have you. Uh and that's what I think we will have in the future as well. You talked about databases, right? I mean take you know man I would love all of Excel to have a database backend, right? In fact I would love for all that to happen immediately. Uh and that database is a good database. I mean databases in fact will be a big thing that'll grow. uh in fact if I think about all of the office artifacts uh being structured better the ability to do the joins between structured and unstructured better because of the agenting what that'll grow the underlying what is infrastructure business it happens the consumption of that is all being driven by agents you could say all that is just in time generated software by a model company that could also be true if we

we will be one such model company too uh and so we will build in so the competition could be uh that we will build a model plus all the infrastructure and provision it and then there will be competition between a bunch of those folks who can do that. H um I guess speaking of model companies you say okay we will also be one of the not only will we have the infrastructure we'll have the model itself right now Microsoft AI's most recent model that was released 2 months ago is 36 and Shabbat arena and there's a I mean you obviously have the IP rights to open so there's a question of first to the extent you agree with that it seems to be behind why is that the case especially given the fact that you could um you theoretically have the right to just like

fork open's monor repo or distill on their models Um yeah, especially if it's a big part of your strategy that we need to have a leading model company. >> Yeah. I mean, so first of all, we are absolutely going to use the OpenAI models uh to the maximum uh across all of our products, right? I mean, that's I think the core thing that we're going to continue to do all the way for the next seven years. Uh and not just use it uh but then add value to it. That's kind of where the analyst in this Excel agent and these are all things that we will do where you know we'll do I'll you know RL fine-tuning we'll do some mid-training runs on top of a GPT family where we have unique data assets and build capability um the MI model the way I think

we're going to think about it is the the good news here in fact with the new agreement is even we can be very very clear that we're going to build a worldclass super intelligence team and go after it with high ambition but that at the same time. We're also going to use this time to be smart about how to use both these things. So that means we will on one end be very product focused on on the other end be very research focused. In other words, uh because we have access uh to the GPT family. The last thing I don't want to do is use my flops in a way that is just duplicative and doesn't add much value. So I want to be able to take uh the flops that we use to generate a GPT family [snorts] and maximize its value while my

MAI flops are being used for let's take the image model that we launched which I think just launched uh it's a number nine in the uh image arena you know we're using it you know both for cost optimization it's on copilot it's in Bing and we're going to use that we have a audio model in copilot which it's got personality and what have you optimized it for our product So we will do those even on the LM Marina we started on the text one I think it was it debuted at night 13 and by the way it was it was done only on whatever 15,000 uh H100s and so it was a very small model and uh so it was again to prove out uh the core capability the instruction following and everything else which but you know we wanted to make sure we can

match what was state-of-the-art and so that shows us given scaling laws what we are capable of doing if you gave more flops to it right so the next thing we will is an omni model where we will take sort of the work we've done in audio, what we've done in image and what we've done in text, that'll be the next pit stop on the MAI side. So when I think about the MAI road map, we're going to build a first class super intelligence team. We're going to continue to drop and do on in the open some of these models, they will either be in our products being used because they're going to be latency friendly, cogs friendly, or what have you, or they'll have some special capability. and we will do real research in order to be ready for some next five, six, seven, eight

break breakthroughs uh that are all needed on this march towards super intelligence. So I think that's and while exploiting the advantage we have of having the GPT family that we can work on top of as well. >> Say we roll forward seven years uh you no longer have access to open AI models. what does one get confidence or what does Microsoft do to make sure they are leading or have a leading AI lab right today you know it's it's all open has developed many of the breakthroughs whether it be scaling or reasoning or Google's developed all the breakthroughs like transformers uh but but it it is also a big talent game right you know you've seen meta spend you know north of20 billion on talent right uh you've seen anthropic uh poach the entire blue shift reasoning team from Google last year you've seen meta

poach a large reasoning and post training team from Google more recently. These these sorts of talent wars are very capital intensive. They're the ones that, you know, arguably, you know, if you're spending hundred billion dollars on infrastructure, you should also spend, you know, x amount of money on on the people using the infrastructure so that they're more efficiently making these new breakthroughs. what what confidence can one get that you know hey Microsoft will have a team that's world class that can make these breakthroughs and you know once you decide to turn on the money faucet you know you're being a bit capital efficient right now which is which is smart it seems uh to not waste money doing duplicative work but once you decide you need to you know how how can one say oh yeah now you can shoot up to where the top

five model >> well look I mean at the at the end of the day we're going to build a world-class team and we already have a world-class team that's beginning to be sort of assembled right Mustafa coming in. We have Karen. We have Amar Subramanyan who did a lot of the post training at Gemini. Tufi who is at Microsoft. Nando who did a lot of the multimedia work at Deep Mind is there. And so we're going to build a worldclass team. And in fact I think later this week even Mustafa published some you know a little more clarity on what our lab is going to go do. Um I think the thing that I want uh the world to know perhaps uh is we are going to build the infrastructure that'll support multiple models. Uh you know uh we because from a hypers scale perspective

we want to build the most scaled infrastructure fleet that's capable of supporting all the models the world needs whether it's from open source or whether it's obviously from open AI and others and so that's kind of one job. Second is in our own model capability. We will absolutely use the open AI model in our products and we will start building our own models and we may like in in GitHub copilot anthropic is used. So we will even have other frontier models that are going to be wrapped into our products as well. So I think that that's kind of how at least each time at the end of the day the eval of the product as it meets a particular task or a job is what matters and we'll sort of back from there into the vertical integration needed. uh knowing that as long as you're

service you know you're serving the market well with the product you can always cost optimize >> there there's a question going forward so right now we have models that have this distinction between training and inference and one could argue that there's like a smaller and smaller difference between the different models um going forward if you're really expecting something like human level intelligence humans learn on the job you know if you think about your last 30 years what makes s token so valuable it's the last 30 years of wisdom and experience you've gained at Microsoft Um and we will eventually have models if they get to human level which will have this ability to continuously learn on the job and that will drive so much value to the model company that is ahead at least in my view because you have copies of one model broadly

deployed through the economy learning how to do every single job and unlike humans they can amalgamate their learnings to that model. So there's this sort of continuous learning sort of exponential feedback loop um which almost looks like a sort of intelligence explosion. uh if that happens and Microsoft isn't the leading model company by that time doesn't then this uh you know you're saying well we substitute one model for another etc matter less because it's just like this one model knows how to do every single job of the economy the other long tale of don't >> yeah no I think your point about if there's one model that is the only model that is most broadly deployed in the world and it sees all the data and it does continuous learning that's game set match and you know is shut right I mean the the reality

at least I see um is the world even today for all the dominance of any one model it's not the case um it's like take any take coding there's multiple models in fact every day it's less the case where there is not one model that is getting deployed broadly in fact there's multiple models that are getting deployed it's kind of like databases right it's always the thing it's like hey can one database be the one that just is used everywhere except it's not uh there are multiple types of databases that are getting deployed uh for different use cases. So I think that there is going to be some network effects of continual learning or data you you know I'll call liquidity that any one model has. Uh is it going to happen in all domains? I don't think so. Is it going to happen in

all geos? I don't think so. Is it going to happen in all segments? I don't think so. It'll happen in all categories at the same time. I don't think so. So therefore I feel like the design space is so large uh that there's plenty of opportunity but your fundamental point is having a capability which is at the infrastructure layer, model layer and at the scaffolding layer and then to be able to compose these things not just as a vertical stack but to be able to compose each thing for what its purpose is. Right? You can't build an infrastructure that's optimized for one model. If you do that what if you go fall behind? In fact, all the infrastructure you built will be a waste, right? You kind of need to build an infrastructure that's capable of supporting multiple sort of families and lineages of models.

Otherwise, the capital you put in which is optimized for one model architecture. That means you're one tweak away from some like breakthrough that happens for somebody else and your entire network topology goes out of the window. Then that's a scary thing, right? So therefore, you kind of want the infrastructure to support whatever may come. in fact in your own model family and other model families and you got to be open if you if you're serious about the hypers scale business you got to be serious about that right um if you're serious about being a model company you've got to basically say hey what are the ways people can actually do things on top of the model so that I can have an ISV ecosystem unless I'm thinking I'll own every category that just can't be that then you won't have an API business and that

by definition will mean you'll never be uh a platform company that's going to be successfully deployed everywhere right So therefore the industry structure is so such that it will really force people to specialize and [snorts] that in that specialization a company like Microsoft should compete in each layer by its merits uh but not think that this is all about all a road to game set match where I just compose vertically all these layers. That's that just doesn't happen. So according to Dylan's numbers, there's going to be half a trillion in AI capex next year alone, and labs are already spending billions of dollars to snag top researcher talent. But none of that matters if there's not enough highquality data to train on. Without the right data, even the most advanced infrastructure and world-class talent won't translate into end value for the user. That's where Libox

comes in. Libox produces highquality data at massive scale, powering any capability that you want your model to have. It doesn't matter whether you need a coding agent that needs detailed feedback on multi-our trajectories or a robotics model that needs thousands of samples on everyday tasks or a voice agent that can also perform real world actions for the user like booking them a flight. To be clear, this isn't just off-the-shelf data. Labelbox can design and launch a custom production scale data pipeline in 48 hours and they can get you tens of thousands of targeted examples in weeks. Reach out at labelbox.com/darkh. All right, back to Satia. >> So last year Microsoft was on path to be the largest infrastructure provider uh by far. You were the earliest in 23. So you you went out there, you acquired all the resources in terms of leasing data center,

starting construction, securing power, everything. You guys were on pace to beat Amazon in 26 or 27. Um but certainly by 28, you were going to beat them. Um since then, you you know, in let's call it the second half of last year, Microsoft did this big pause, right, where they let go of a bunch of leasing sites that they were going to take, which then Google, Meta, um Amazon, in some cases, Oracle, uh took these sites. We're sitting in one of the largest data centers in the world. So obviously it's not everything. You guys are expanding like crazy. Uh but there are sites that you just stopped working on. >> Why why did you do this? Right. >> Yeah. I mean the fundamental thing we this goes back a little bit to what is the hypers scale business all about right which is one of

the key decisions we made was that if you're going to build out Azure to be fantastic for all sort of stages of AI uh from training to mid-training to data genen to inference we just need fungibility uh of the fleet um and and so that entire thing caused us not to basically go build a a whole lot of capacity with a particular set of generations. Uh because the other thing that you got to realize is having actually for up to now 10xed every 18 months enough training capacity for the various open AI models. uh we realize that um the key is to stay on that path but the more important thing is to actually have a balance to not just train but to be able to serve these models all around the world because at the end of the day the rate of monetization is

what then will allow us to even keep uh funding and then the infrastructure was going to need us to support as I said multiple models and what have you. So once we said that that's the case since then we just course corrected to where the path we're on right if I look at the path we're on is we're doing lot more starts now uh we're also buying up as much capacity as we can whether it's to build whether it's to lease or even GPUs as a service but we're building it for where we see the demand uh and the serving needs and our training needs and we didn't want to just be a host for one company uh and have just a massive book of business with one customer that that's not a business right that is sort of uh you know you should be

vertically integrated with that company uh and so given the the thing that openai was going to be a successful independent company which is fantastic right I think it's makes sense right and even meta may use third party capacity but ultimately they're all going to be first party uh for anyone who has large scale they'll be you know they'll be a hyperscaler on their own and so to me was to build out a hypers scale fleet and our own research compute. Uh and that's what the adjustment was. Um you know and then and so I feel very very good. Oh by the way the other thing is I didn't want to get stuck with massive scale of one generation. I mean we just saw the the GB200s. I mean the GB300's are coming right and by the time I get to Vera Rubin Ver Rubin ultra

guess what the data center is going to look very different because the power per rack power per row is going to be so different uh the cooling requirements are going to be so different and that that means I don't want to just go build out like a whole number of gigawatts that are only for one generation one family and so I think the pacing matters and the funibility and the location matters uh the workload diversity matters, customer diversity matters and that's what we're building towards. The other thing that we've learned a lot is um every AI workload does require not only the AI accelerator but it requires a whole lot of other things right and in fact a lot of the margin structure for us will be in those other things and so therefore we want to build out Azure as being fantastic for the

long tail of the workloads because that's the hypers scale business while knowing that we've got to be super competitive starting with the bare metal for the highest end training And but that can't crowd out the rest of the business, right? Because we're not in the business of just doing five contracts with five customers being their bare metal service. That's not a a Microsoft business. That may be a business for someone else and that's a good thing. What we have said is we are in the hypers scale business which is at the end of the day a longtail business uh for AI workloads and in order to do that we will have some leading bare metal as a service capabilities for a set of models including our own uh and that I think is the balance you see the another sort of question that comes around

this whole fungeibility topic is okay it's not where you want it right you would rather have it in a good population center like Atlanta we're here um there there's there's There's also the question of like well how much does that matter if as the horizon of AI tasks grows well actually you know 30 seconds for a reasoning prompt or you know 30 minutes for a deep research or you know it's going to be hours for software agents at some point um and days and so on and so forth the time to human interaction why does it matter if it's if it's a great it's a great question >> a location A B or C >> that's exactly right so in fact that's one of the other reasons why we want to think about like hey what is an Azure region look like and what is

the in fact the networking between Azure regions. So this is where uh I think as the model capabilities evolve and I think the usage of these tokens whether it's synchronously or asynchronously evolves and in fact you don't want to be out of position right then on top of that by the way what are the data residency laws right where do I like I mean the entire EU thing uh for us where we literally had to create an EU data boundary basically meant that you can't just round trip a call to wherever even if it's asynchronous and so therefore you need to have maybe regional things that are high density and then the power costs and so on. But you're 100% right in bringing up that the topology as we build out uh will have to evolve one for tokens per dollar per watt uh what

are the economics overlay that with what is the usage pattern um usage pattern in terms of synchronous asynchronous but also what is the compute storage because the latencies may matter for certain things uh the storage better be there if I have a Cosmos DB close to this for session data or even for an autonomous thing then that also has to be somewhere close to it and so on. So I think that all of those considerations is what will shape uh the hypers scale business. M >> you know prior to the pause you were you were you you know versus you know what we had forecasted for you by 28 you're going to be like 12 13 gawatt and now we're at you know 9 and a half or so right but you know something that's even more relevant right and it's it's you know I

just want you to like more concretely state that this is the business you don't want to be in but like Oracle is going from like 1/5if your size to bigger than you by end of 2027 and while it's not a Microsoft level quality of return on invested capital right they're still making 35% gross margins, right? sort of the question is like does it is it isn't it is it is it you know hey it's not Microsoft's business to maybe do this but you've created a hyperscaler now by refusing this business by giving away the right of first refusal whatever I'm not first of all I don't I don't want to take away any thing from the success Oracle has had in building their business and I wish them well and so the thing that I think I've answered for you is it didn't make sense

for us uh to go be a host for one model company uh with limited time horizon RPO let's let's just put it that way right the thing that you have to think through is not what you do in the next 5 years but what do you do for the next 50 uh because that's kind of what I we made our set of decisions um I feel very good about our open AI partnership and what we're doing we have a decent book a book book of business we wish them a lot of success in fact we are buyers even of Oracle capacity we wish them success but you know at this point. I think the industrial logic for what we're trying to do is pretty clear which is it's not about like chasing I first of all I track by the way your uh things whether

it's the AWS or the Google and ours which I think is super useful uh but doesn't mean I got to chase those uh I have to chase them for not just uh the gross margin that they may represent in a period of time you know does m what what is this book of business that Microsoft uniquely can go clear which makes sense for us to clear and that's what we'll do. I I guess I have a question even stepping back from this of okay I I take your point that it's a better business to be in all else equal to have a long tale of customers you can have higher margin from rather than just serving bare metal to a few labs but then there's a question of okay which way is the industry evolving and so if we believe we're on the path to

smarter and smarter AIs then why isn't the shape of the industry that the open AIs and anthropics and deep minds are the platform which the long tale of enterprises are actually doing business with where they need bare metal but like they are the platform. What is the longtail that is directly using Azure um because you know you you want to use the general >> going to be available on Azure right? So any workload that says hey I want to use um you know some open source model and an open AI model like I mean if you go to Azure foundry today you have all these models that you can provision buy PTUs get a cosmos DB get a SQL DB get some storage get some compute that's what a real workload looks like a real workload is not just hey I did an API call

to a model a real workload needs all of these things to go build an app or instantiate an application in fact the model companies need that right to build anything it's just not like I have a token factory I have to have all of these things that's the hypers scale business uh and it's not any one model but all these models and so if you want grock plus let's say uh open AI plus an open source model come to Azure foundry provision them build your application here is a database that's kind of what the business is uh you there is a separate business called just selling raw bare metal services to model companies and that's the argument about how much of that business you want to be in and not be in and what is that it's a very different segment of the business which

we are in and we also have limits to how much of it is going to crowd out the rest of it. Uh but that's kind of at least the way I look at it. So, so there's there's sort of two questions here, right? Like why why couldn't you just do both is one and then the other one is um given, you know, our our estimates on what your capacity is in 2028 is 3 and a half gigawatts lower. Sure, you could have dedicated that to OpenAI training and inference capacity, but you could have also dedicated that to hey the this three and a half gigawatts is actually just running Azure is running Microsoft 365 that's running GitHub copilot. it doesn't actually I could have built it and not given it to open AAI >> or I may want to build it in a different location.

I may want to build it in UAE. I may want to build it in India. I may want to build it in Europe. Right? So one of the other things is as I said like where we have real capacity constraints right now are given the regulatory needs and the data sovereignty needs. We got to build all over the world. Uh it's first of all state side capacity is super important and we're going to build everything. But one of the things is when I look out to 2030 uh I have a sort of a global view of what does Microsoft shape of business by first party and third party third party segmented by the frontier collabs and their how much they want versus the inference capacity we want to build for multiple models um and our own research compute needs right so that's all what's going

into my calculus versus saying hey um I think you're rightfully pointing out the pause but the pause was not done because we said oh my god we don't want to build that we realized that oh we want to build what we want to build slightly differently uh by both workload type as well as geo type and timing as well like we'll keep ramping up our gigawatts and the question is at what pace and in what location and in what sort of how do I write even the mos's law on it right which is do I really want to overbuild 3 and a half in 27 or do I want to spread that in 2728 knowing even one of the biggest learnings we had even with Nvidia is their pace increased uh in terms of their model I mean their migrations so that was a big

factor I didn't want to go get stuck for four years 5 years of depreciation on one uh generation and I wanted to just basically buy like in fact Jensen's advice to me was two things one is hey get on the speed of light execution that's why I think even the execution in this Atlanta data center I mean like in 90 days right between when we get it and to hand off to a real workload. that's sort of real speed of light execution on their front and so I wanted to get good at that and then that way then I'm building this each generation and scaling uh and then every 5 years then you have a much more balanced so it becomes really literally like a flow uh for a large scale industrial operation like this where you suddenly are not lopsided where you built up

a lot in one time and then you take a ma massive hiatus because you're stuck with all this to your point in one location which may be great for training, may not be great for infants because I can't serve even if it's like it's all asynchronous, but Europe ain't going to let me round trip to Texas. So, that's all of the things. >> How do I rationalize this statement with what you've done over the last few weeks? You've announced deals with Iris Energy, um with Nebius, um and Lambda Labs, and there's a few more coming as well. Uh you're you're going out there and securing capacity that you're renting from the Neoclouds, um rather than having built it yourself. What was the what was >> I think it's it's fine for us because we now have you know when you have line of sight to

demand which can be served where people are building it it's great in fact we'll even have I would say you know we will take leases we will take build to suite we'll take even GPUs as a service where we don't have capacity but we need capacity and someone else has that uh and by the way I would even sort of welcome every Neocloud to just be part of our marketplace uh because again guess what if if they go bring their capacity into our marketplace. That customer who comes through Azure will use the Neocloud which is a great win for them and we'll use compute, storage, databases, all the rest from Azure. So I'm not at all thinking of this as just a you know hey I should just gobble up all of that myself. M um so you mentioned the how the you know you're

depreciating this asset that's 5 six years and this is the majority of the you know 75% of the TCO of a data center and Jensen is taking a 75% margin on that so what all the hyperscalers are trying to do is develop their own accelerator so that they can reduce this overwhelming cost for um uh equipment to increase their margins. >> Yeah. And then and then like you know when you look at where they are right Google's way ahead of everyone else right they've been doing it for the longest they're going to make something like 5 to 7 million chips right of their own TPUs you look at Amazon they're trying to make 3 to 5 million but when we look at what you know Microsoft is is ordering of their own chips it's it's it's way below that number um you've had a program

for just as long what's going on with your internal >> good question so so the couple of things one is the thing that is the biggest competitor for any new accelerator is kind of even the previous generation of Nvidia right I mean in a fleet what I'm going to look at is the overall TCO so the bar I have even for our own and which by the way you know I was just looking at the data for Maya 200 which looks great um a except that one of the things that we learned even on the compute side right which is we had a lot of Intel then we introduced AMD and then we introduced cobalt and so that's kind of how we scaled it and so we have good um sort of existence proof of at least in core compute on how to build your

own silicon and then manage a fleet where all three are at play in some balance. Uh because by the way even Google's buying Nvidia and so is uh Amazon. It makes sense because Nvidia is innovating and it's the general purpose thing. All models run on it. Uh and customer demand is there because if you build your own vertical thing, you better have your own model uh which is you know either going to use it for training or inference and you have to generate your own demand for it or subsidize the demand for it. So therefore you want to uh make sure um you scale it appropriately. So the way we're going to go do it is um have a closed loop between our own MAI models and our silicon because I feel like that's the that's what gives you the birthright to really do your

own silicon right where you literally have uh designed the micro architecture with what you're doing and then you keep pace with your own models. Um in our case the the good news here is OpenAI has a program uh which we have access to. Um and so therefore to think that Microsoft is not going to have something that's >> what level of access do you have to that >> all of it. >> You just get the IP for all of that. So the only IP you don't have is a consumer hardware. >> That's it. >> Oh wow. Okay. >> Yeah. Interesting. >> Yeah. And by the way we gave them a bunch of IP as well to bootstrap them. Right. So this is one of the reasons why they had a mass because we built all these supercomputers together uh or we built it for them

and they uh benefited from it rightfully so and uh and now as they innovate even at the system level we get access to all of it uh and uh we first wants to want to instantiate what they build uh for them uh but then we'll extend it and so to think that we don't have and so if anything the way I I think about to your question is Microsoft wants wants to be a fantastic I'll call it speed of light execution partner for Nvidia because quite frankly that fleet uh is life itself. I'm not worried about I mean obviously Jensen is doing super well with his margins but the TCO has many dimensions to it and I want to be great at that TCO. Uh on top of that, I want to be able to sort of really work with the OpenAI lineage uh and

the MAI lineage and the system design knowing that we have the IP rights on both ends. >> Uh speaking of rights, one thing you know, you had an interview a couple days ago uh where you said that we have rights to the the new agreement you made with OpenAI. have right the exclusivity to the stateless API calls that OpenAI makes and we were sort of confused about if there's any state whatsoever. I mean you were just mentioning a second ago that all these complicated workloads that are coming up are going to require memory and databases and storage and so forth and is that now not stateless of chat GPT is storing stuff on >> that's the reason why so the the thing the business the strategic decision we made and also accommodating for the flexibility open AI needed in order to be able to procure

compute for essentially think of open AI having um a pass business and a SAS business SAS business is chat GPT that pass business is their API. >> That API is Azure exclusive. >> The SAS business, they can run it anywhere >> and they can partner with anyone they want to to build SAS products. >> So if they want to partner and the partner wants to use a a stateless API, then Azure is the place where they can get the stateless API. >> It seems like there's a way for them to make you you know build the product together and and it's a state. >> No, even that they'll have to come to Azure. Okay. So if it is any partner and so so fundamentally you know so again this is done in the spirit of what is it that we valued as part of our

partnership and we made sure while at the same time we were good partners to open AAI given all the flexibility they need. So for example, Salesforce wants to integrate OpenAI. It's not through an API. They actually work together, train a model together, deploy it on let's say Amazon. Now is that is that allowed or uh or do they have to use >> for any custom agreement like that? They will have to come run it. There are some few exceptions to US government and so on that we made, but other than that, they'll have to come to Azure. >> So as s explained, as AI agents get more capable, you're going to need more and more observability into what they're doing. You're going to need to catch them when they're making mistakes. You're going to need highle summaries of what they're doing and you're going to

need a picture of how everything that they're doing fits together. This is exactly what Code Rabbit provides. You just make a normal pull request and Code Rabbit automatically reviews the PR. It generates a summary of changes so you can understand exactly what the PR's author was intending and it uses the context from your full code base to provide line by line feedback on how things could be improved. This is helpful whether you're reviewing a PR from a co-orker or an agent. In either case, Code Rabbit will write up its thoughts and flag any issues so that your teammate or your agent can go fix them. I've noticed that when I'm coding with agents, Code Rabbit catches a lot of mistakes that the models make by default. For example, the models have a bad habit of using old versions of libraries. So, in one session, I

watch Code Rabbit cache a call to an old model, figure out what the new version was, and then suggest that improvement. Go to code rabbit.a a/4 to learn more. >> Stepping back, a question I have is, you know, when we were walking back and forth with the factory, one of the things we're talking about is, you know, Microsoft, you can think of it as a software business, but now it's really becoming an industrial business. Uh, there's all this capex, there's all this construction, and if you just look over the last two um two years, your sort of capex is like tripled. And maybe you extrapolate that forward. It just actually just becomes this huge industrial uh explosion. >> Well, their hyperscalers are taking loans, right? Meta's Meta's done a $20 billion loan at Louisiana. They've take they've done a corporate loan. It seems clear everyone's

free cash flow is going to zero. Um which is which I'm sure Amy is like going to beat you up for for even if you even try to do that. But like uh what what what's happening? I mean I think I think the structural change um is what you're referencing which I think is massive right which is I I describe it as we are now a capital intensive business and a knowledge intensive business and in fact we have to use our knowledge to increase the ROIC on the capital spend right because that's kind you know look the hardware guys have done a great job uh of marketing the morals law which I think is unbelievable and it's great but if you even look I think some of the stats I even did in my earnings call which is for a given GPT family right uh

the improvement software improvements of really throughput in terms of tokens per dollar per watt that we're able to get uh you know quarter over quarter year over year is massive uh right so it's 5x 10x maybe 40x in some of these cases right just because uh how you can optimize that's sort of knowledge intens intensity coming to bring out capital efficiency >> so that at at some level the that's what we have to master. What does it mean? Like somebody people ask me what was the difference between uh you know a classic oldtime host and a hyperscaler it was software. So yes it is capital intensive but as long as you have systems knowhow software capability to optimize by workload by fleet that's why I think when when we say fungeibility there's so much software in it. It's just not about the fleet, right? It's

kind of the ability to evict a workload, you know, and then schedule another workload. Can I like manage the that algorithm of scheduling around u that is the type of stuff that we have to be world class at? And so yes, so I think we'll still remain a software company. >> Uh but yes, this is a different business. Um and we're going to manage. Look, I think at the end of the day, uh the cash flow that Microsoft has allows us to have um both these arms firing, you know, uh well, >> it seems like in the short term you have more sort of um credence on things taking a while, being more jagged, but in the maybe in the long term, you think like the people who say talk about AGI and ASI are correct like Sam Sam will be right, but eventually. Um

and I I have a broader question about what makes sense for a hyperscaler to do given that you have to invest massively in this thing which depreciates over 5 years. So so you if you have 2040 timelines to the kind of thing that somebody like Sam anticipates in three years um you know what what is a reasonable thing for you to do in that world? there needs to be an allocation uh to I'll call it research compute >> that needs to be done like you did R&D >> right so that's the best way to even account for it quite frankly we should think of it as just R&D expense and you should say hey what's the research computer and know how do you want to scale it >> um and let's [clears throat] even say it's an order of magnitude scale um in some period

pick your thing is it two years is it 16 months what have you Right. So that's sort of one piece which is kind of that's kind of table stakes. That's R&D expenses and the rest is all demand driven. Right. I mean ultimately you can you have to build ahead of demand but you better have a demand uh uh plan uh that doesn't go completely offkilter. Do you buy so these labs are now projecting revenues of 100 billion in 2728 uh and they're projecting you know revenue keeps growing at this rate of like 3x 2x a year >> a lot in the marketplace right there's all kinds of incentives right now and and rightfully so right I mean what what do you expect an independent lab that is sort of trying to raise money to do right they have to put some numbers out there such

that they can actually go raise money so that they can pay their bills for compute and what have you and it's And it's good thing I someone's going to take some risk and put it in there and they've shown traction. It's not like it's all risk without seeing the fact that they've been performing whether it's open AAI, whether it's anthropic. So I feel great about what they've done. >> Uh and we have massive book of business with these Japs. So therefore uh that's all good. >> But overall ultimately there's two simple things. One is you got to allocate for R&D. You brought up even talent. You got to like the talent for AI is at a premium. You got to spend there. You got to spend on compute. So in some sense researcher to GPU ratios have to be high. Uh that is sort of

what it takes to be a leading R&D company in this world. Uh and that's something that needs to scale. Um and you have to have a balance sheet that allows you to scale that long before it's conventional wisdom and so on. So that's kind of one thing. But the other is all about sort of knowing how to forecast >> as we look across the world right America has dominated many tech stacks right um the US owns Windows right through Microsoft which is deployed even in China right that's the main operating system um of course there's Linux which is open source but you know Windows is deployed everywhere in China on personal computers um you look at you look at word it's it's deployed everywhere you look at all these various technologies it's deployed everywhere the thing that is quite unique and and and Microsoft and

other companies have grown elsewhere, right? they've built they're building data centers in Europe and in India and in and in all these other you know in Southeast Asia and in Latam in Africa right all of these different places you're building capacity but this seems quite different right you know to today the political aspect of technology of compute you know you know the US administration didn't care about the dotcom bubble right um it seems like the US administration as well as every other administration around the world cares a lot about AI and the question is you know we we're in sort of a bipolar world at least with US and China but Europe and and India and all these other countries are are saying no actually we're going to have sovereign AI as well. How does Microsoft navigate, you know, the difference of the 90s where

it's like there's one country in the world that matters, right? It's America and we do our companies sell everywhere and therefore Microsoft benefits massively to a world where it is bipolar where hey Microsoft can't just necessarily have the right to win all of Europe or India or you know Singapore. There's actually sovereign AI efforts. What what is your thought process here and how do you think about this? It's it's I think a super you know critical um piece which is um I think that the key key priority for the US tech sector and the US government is to ensure that we not only do leading innovative work but we also collectively build trust around the world on our tech stack right because I always say the United States is just an unbelievable place It's just unique in history, right? It's 4% of the world's population,

25% of the GDP, and 50% of the market cap. And I think you should think about those ratios and uh really and reflect on it. that 50% happens because quite frankly the trust the world has in the United States whether it's its capital markets or whether it's its technology and and its stewardship of what matters at any given time in terms of leading uh sector. So if that is broken uh then that's not a good day for the United States. And so if we start with that which I think the you know President Trump gets, the White House, David Sachs, everyone uh really I think gets it. Uh and so therefore I applaud anything that the United States government and the tech sector jointly does to quite frankly for example put our own capital at risk collectively as an industry in every part of the

world. Right? So I would like in fact the USG to take credit for foreign direct investment by American companies all over the world right it's kind of like uh least talked about but the best marketing that the United States should be doing is it's not just about all the foreign direct investment coming into the United States but the most leading sector which is these AI factories are all being created all over the world by whom by America and American companies and so you start there and Then you even build other agreements around it which are around their continuity, their legitimate sovereignty concerns around whether it's data residency, whether it's even what happens um uh for them to have real agency and guarantees uh on privacy and so on and so that in fact our European commitments I think are worth reading. Right? So we made

a series of commitments to Europe on how we will really govern our hypers scale investment there uh such that really European uh union and the European countries have sovereignty. We're also building sovereign clouds in in France and in Germany. We have something called sovereign services on Azure which literally give people key management services along with confidential computing including confidential computing in GPUs which we've done great innovative work with Nvidia. Um and so I think I feel very very good about being able to build both technically and through policy this trust in the American tech stack. M and how do you see the shaking out as you know you do have this uh network effect with learning and things on the model level maybe you have equivalent things at the hyperscaler level as well and do you expect that the countries will say look it's clearly

one model or a couple models are the best and so we're going to use them but we're going to have some laws around well the weights have to be hosted in our country or do you expect that there will be uh this push to have it has to be a model trained in our country maybe an analogy here is like people would you know the semiconductor is very important to the economy and people would like to have their sort of sovereign semiconductors but like TSMC is just better and so semiconductors are so important to the economy that you will just go to Taiwan and buy the semiconductors you have to will it be like that with AI or is there >> um ultimately I think what matters is the use of AI in their economy to create economic value right I mean that's the uh

the diffusion theory which is ultimately it's not the leading sector but it's the ability to use the leading technology to create your own comparative advantage right so that I think will fundamentally be the core driver >> but that said they will want continuity of that right so in some sense that's one of the reasons why I believe there's always going to be a check a little bit to sort of some of your points on hey can this one model have all the runaway deployment that's why open source is always going to be there they will be by definition uh multiple models that'll be one way like it's kind of the you know that's one way for people to sort of demand continuity and not have concentration risk is another way to say it is right um and so you say hey I want multiple models

and then I want an open source so I feel uh as long as that's there every country will feel like okay I don't have to worry about deploying the best model and broadly diffusing because I can always take uh what is my data and my liquidity and move it uh to another model whether it's open source or from another country or what have you. So concentration risk >> um and sovereignty right which is really agency those are the two things I think that'll drive the market structure. The the thing about this is that this doesn't exist for semiconductors, right? You know, all refrigerators, cars have chips made in Taiwan. >> It didn't exist until now. Until now, everybody is now like like >> even even then, right, America, you know, if Taiwan is cut off, there is there are no more cars, there are no

more refrigerators. TSMC Arizona is not replacing any real fraction of the production. Like there it is. It there the sovereignty is a bit of like a a scam, if you will, right? I mean, it's it's worthwhile having it. It's important to have it, but it's not a real it's not real sovereignty, right? And we're a global economy. We don't we >> I think it's kind of like Dylan saying, hey, at this point, we've not learned anything about sort of uh what resilience means and what one needs to do, right? So, it's kind of any nation state, including the United States at this point, will do what it takes to be more self-sufficient on some of these critical supply chains. So I as a multinational company have to think about that as a first class requirement right if I don't then I'm not respecting what is

in the sort of policy interests of that country long term right and I'm not saying they won't make practical decisions in the short term right absolutely I mean the globalization can't just be rewound right I mean all these capital investments cannot be made uh in in a way at the pace at which at the same time you have to kind of like if I think about it, right? If somebody showed up in Washington and said, "Hey, you know, you know what? We're not going to build any semiconductor plans, they're going to be kicked out of the United States." Um, and and the same thing is going to be the true in every other country, too. Uh, and so therefore, I think we have to as companies respect what the lessons learned are. Um, you know, whether it's, you know, you could say the pandemic woke

us up or whatever. But nevertheless, people are saying, "Look, globalization was fantastic. uh it helped the supply chains be globalized and be super efficient but there's such a thing called resilience and we are happy you know we want resilience and so therefore that feature will get built at what [snorts] pace I think you point you're making it can't be like you can't snap your fingers and say all the TSMC plants now are all in Arizona and with all of the capability they're not going to be but is there a plan there will be a plan and should we respect that absolutely and so I I feel that's the world I want to meet the world where it is and what it wants to do going forward as opposed to say hey we have a point of view that doesn't respect your view. M so ju

just to make sure I understand the idea here is each country will want some kind of data residency privacy etc. And Microsoft is especially privileged here because you have relationships with these countries who have expertise in setting up these kinds of sovereign data centers and therefore Microsoft is uniquely fit for a world with um more sovereignty requirements. >> Yeah. I mean I I I don't want to sort of describe it as somehow we're uniquely privileged. Uh I would just say I think of that as a business requirement that we have been doing all the hard work all these decades and we plan to and so my answer to Dylan's previous question was I take these you know whether it's in the United States quite frankly uh when you know when the white house and the USG says hey we want you to allocate more of

your I don't know wafer starts to uh uh fabs in the US we take that seriously. or whether it is data center and the EU boundary, we take that seriously. So to me, >> um respecting what I think are legitimate reasons why countries care about sovereignty and building for it as a software and a physical plant is what I I would say we are going to do. And as we go to like the bipolar world, right, US, China. Yeah. Um there is there is a lot around, >> you know, American tech does not, you know, it's not just you versus Amazon, um or you versus, you know, anthropic or you versus Google. Yeah. There is a whole host of competit competition. How does how does America rebuild the trust? What do you do to rebuild the trust to say actually no, American companies will be

the main provider for you? Um and how do you think about competition with up and cominging Chinese companies whether it be you know bite dance and Alibaba or Deepseek and Moonshot >> and so just add to the question one concern is look we're talking about how AI is becoming this sort of industrial capex race uh where you're just rapidly having to build quickly across all those supply chain when you hear that at least till now you just think about China right this is like their comparative advantage and especially if we're not going to moonshot to ASI next year but we it's going to be this decades of buildouts and infrastructure and so forth, how do you deal with Chinese competition? Are they privileged in that world? >> Yeah. So, it's a great qu. I mean, in fact, you just made the point of why I

think trust in American tech is probably the most important feature. It's not even the model capability. Maybe it is like can I trust you the company? Can I trust you? Your country and its institutions to be a long-term supplier may be the thing that wins the world. >> That's a good note to end on. >> Yeah, >> Satia, thank you for doing this. >> Thank you so much. Thank you. It's such a pleasure. Such a pleasure. >> It's awesome. It's like, man, you two guys are like quite the team. >> Hey everybody, I hope you enjoyed that episode. If you did, the most helpful thing you can do is just share it with other people who you think might enjoy it. It's also helpful if you leave a rating or a comment on whatever platform you're listening on. If you're interested in sponsoring the podcast,

you can reach out at dwarcash.com/advertise.